ARHGAP32

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038382

 

Antibody HPA038389

 

Antibody HPA061505

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA038382 HPA038389 HPA061505 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 7 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

95 90 90 

Antigen sequence

AVATTEDNLSSSYSAVALDKAYFQTDRPAEQFHLQNNAPGNCDHPLPETT
ATGDPTHSNTTESGEQHHQVDLTGNQPHQAYLSGDPEKARITSVP
 
ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVFGGGGMGT
YVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE
 
PNDHNVVSMPPAADVKHTYTSWDLEDMEKYRMQSIRRESRARQKVKGPVM
SQYDNMTPAVQDDLGGIYVIHLRSKSDPGKTGLLSVAEGK
 

Matching transcripts

ARHGAP32-001 - ENSP00000310561 [100%]
ARHGAP32-002 - ENSP00000432862 [100%]
ARHGAP32-006 - ENSP00000376425 [100%]
 ARHGAP32-001 - ENSP00000310561 [100%]
ARHGAP32-002 - ENSP00000432862 [100%]
ARHGAP32-006 - ENSP00000376425 [100%]
 ARHGAP32-001 - ENSP00000310561 [100%]
ARHGAP32-002 - ENSP00000432862 [100%]
ARHGAP32-006 - ENSP00000376425 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebellum shows cytoplasmic positivity in purkinje cells along with neuronal processes.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic and membrane positivity in glandular cells.
More information
 Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes and strong cytoplasmic and nuclear positivity in bile duct cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:75 1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data Not done 

         Western Blot

Image

   

Description

  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

230.5, 191.0 230.5, 191.0 230.5, 191.0 

Antibody dilution

1:250 1:250 1:80 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARHGAP32-001
 
ARHGAP32-002
 
ARHGAP32-006