ANXA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011271

 

Antibody HPA011272

 

Antibody CAB013023

 

Antibody CAB035987

 

Antibody CAB058693

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Zymed
 NCI-CPTC
 Atlas Antibodies
 

Product name

HPA011271 HPA011272 71-3400 CPTC-ANXA1-1 AMAb90558 

Host species

Rabbit Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G Protein A/G 

Released in version

4 4 4 7 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known Recombinant protein Recombinant protein 

Length (aa)

126 102    

Antigen sequence

FRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTIL
TTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKP
AFFAEKLHQAMKGVGTRHKALIRIMV
 
MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAA
LHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKAL
TG
 
 
 
 

Matching transcripts

ANXA1-002 - ENSP00000257497 [100%]
ANXA1-003 - ENSP00000366109 [100%]
 ANXA1-002 - ENSP00000257497 [100%]
ANXA1-003 - ENSP00000366109 [100%]
ANXA1-004 - ENSP00000412489 [100%]
ANXA1-006 - ENSP00000414013 [100%]
    

Other gene match

     

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human bronchus shows strong membranous and cytoplasmic positivity in respiratory epithelial cells.
More information
 Immunohistochemical staining of human bronchus shows strong membranous and cytoplasmic positivity in respiratory epithelial cells.
More information
 Immunohistochemical staining of human esophagus shows distinct nuclear and cytoplasmic positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human nasopharynx shows strong cytoplasmic, nuclear and membranous positivity in respiratory epithelial cells.
More information
 Immunohistochemical staining of human bronchus shows strong positivity in respiratory epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1250 1:125 1:1500 1:15000 1:1000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done Not done 

         Immunofluorescence

Image

     

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:111 1:14 1:200 1:2500  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

     

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

38.7 38.7, 22.8, 12.6 38.7, 22.8, 12.6 38.7, 22.8, 12.6 38.7, 22.8, 12.6 

Antibody dilution

1:250 1:250 1:500 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:500    

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
ANXA1-002
 
ANXA1-003
 
ANXA1-004
 
ANXA1-006