CD36

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002018

 

Antibody CAB025866

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D systems
 

Product name

HPA002018 MAB1955 

Host species

Rabbit Rat 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

137  

Antigen sequence

VVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPY
TYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLA
VAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLREL
 
 

Matching transcripts

CD36-001 - ENSP00000399421 [100%]
CD36-003 - ENSP00000407690 [100%]
CD36-006 - ENSP00000308165 [100%]
CD36-012 - ENSP00000392298 [100%]
CD36-015 - ENSP00000415743 [100%]
CD36-016 - ENSP00000378268 [100%]
CD36-201 - ENSP00000411411 [100%]
CD36-202 - ENSP00000401863 [100%]
CD36-204 - ENSP00000441956 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:400 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400018)
More information
  

Target mass (kDa)

53.1, 52.1, 48.6, 32.3, 22.7 53.1, 52.1, 48.6, 46.1, 44.7, 32.3, 22.7, 16.2, 15.7, 11.0, 10.3, 7.3, 7.0 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CD36-001
 
CD36-003
 
CD36-006
 
CD36-012
 
CD36-015
 
CD36-016
 
CD36-201
 
CD36-202
 
CD36-204