GLUL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007316

 

Antibody HPA007571

 

Antibody CAB008636

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 AbFrontier
 

Product name

HPA007316 HPA007571 LF-PA0100 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Ammonium Sulfate Precipitation 

Released in version

3 3 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

141 139  

Antigen sequence

LQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTC
KRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGA
DRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGP
 
RVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEK
LSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIP
RTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
 
 

Matching transcripts

GLUL-001 - ENSP00000356537 [100%]
GLUL-002 - ENSP00000344958 [100%]
GLUL-201 - ENSP00000307900 [100%]
GLUL-202 - ENSP00000398320 [100%]
 GLUL-001 - ENSP00000356537 [100%]
GLUL-002 - ENSP00000344958 [100%]
GLUL-201 - ENSP00000307900 [100%]
GLUL-202 - ENSP00000398320 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in subsets of glial cells.
More information
 Immunohistochemical staining of human stomach shows moderate cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic and nuclear positivity in glial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:10 1:750 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400756)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400756)
More information
  

Target mass (kDa)

42.1 42.1 42.1 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus, cytoplasm & mitochondria.
More information
 

Antibody dilution

 1:5 1:188 

Validation IF

 Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
GLUL-001
 
GLUL-002
 
GLUL-201
 
GLUL-202