CEP350

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028355

 

Antibody HPA028357

 

Antibody HPA030845

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA028355 HPA028357 HPA030845 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

104 102 95 

Antigen sequence

ESEAKKLAGASINYGSAWNTEYDVQQAPQEDGPWTKAVTPPVKDDNEDVF
SARIQKMLGSCVSHATFDDDLPGVGNLSEFKKLPEMIRPQSAISSFRVRS
PGPK
 
QDWFDEDFGLSSSHKIQKNKAEETIVPLMAEPKRVTQQPCETLLAVPHTA
EEVEILVHNAAEELWKWKELGHDLHSISIPTKLLGCASKGLDIESTSKRV
YK
 
QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHIS
DAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ
 

Matching transcripts

CEP350-001 - ENSP00000356579 [100%]
 CEP350-001 - ENSP00000356579 [100%]
CEP350-005 - ENSP00000401608 [100%]
CEP350-007 - ENSP00000412460 [100%]
 CEP350-001 - ENSP00000356579 [100%]
CEP350-008 - ENSP00000407044 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts and leydig cells.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
  

Retrieval method

HIER pH6 HIER pH6  

Antibody dilution

1:50 1:20  

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  

         Western Blot

Image

   

Description

Target too small/large to be analyzed with the present setup Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

350.9 350.9, 147.2, 66.8 350.9, 36.8 

Antibody dilution

 1:250 1:250 

Validation WB

 Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & centrosome.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in centrosome.
More information
 

Antibody dilution

 1:20 1:106 

Validation IF

 Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
CEP350-001
 
CEP350-005
 
CEP350-007
 
CEP350-008