NEK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019062

 

Antibody HPA043230

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA019062 HPA043230 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

101 88 

Antigen sequence

NLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVA
RLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRIALGNEAST
V
 
RGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEG
FLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEED
 

Matching transcripts

NEK3-201 - ENSP00000339429 [99%]
NEK3-202 - ENSP00000367341 [99%]
NEK3-001 - ENSP00000449608 [84%]
NEK3-002 - ENSP00000383210 [84%]
NEK3-003 - ENSP00000448782 [84%]
NEK3-203 - ENSP00000404197 [84%]
 NEK3-002 - ENSP00000383210 [100%]
NEK3-201 - ENSP00000339429 [100%]
NEK3-202 - ENSP00000367341 [100%]
NEK3-203 - ENSP00000404197 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:750 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

58.0, 57.7, 55.9, 34.4 58.0, 57.7, 55.9 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:12000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
NEK3-001
 
NEK3-002
 
NEK3-003
 
NEK3-201
 
NEK3-202
 
NEK3-203