CIDEB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001272

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001272 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

115 

Antigen sequence

MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKG
LTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLM
VLQSGQSWSPTRSGV
 

Matching transcripts

CIDEB-001 - ENSP00000258807 [100%]
CIDEB-002 - ENSP00000337731 [100%]
CIDEB-003 - ENSP00000451089 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:250 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

24.7 

Antibody dilution

1:500 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CIDEB-001
 
CIDEB-002
 
CIDEB-003