TANK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037676

 

Antibody CAB010345

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA037676 sc-8314 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

84  

Antigen sequence

EQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIID
KLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLT
 
 

Matching transcripts

TANK-001 - ENSP00000259075 [100%]
TANK-002 - ENSP00000376505 [100%]
TANK-003 - ENSP00000385983 [100%]
TANK-004 - ENSP00000385487 [100%]
TANK-006 - ENSP00000399934 [100%]
TANK-008 - ENSP00000384492 [100%]
TANK-012 - ENSP00000392776 [100%]
TANK-021 - ENSP00000412622 [100%]
TANK-022 - ENSP00000388930 [100%]
TANK-201 - ENSP00000415276 [100%]
TANK-014 - ENSP00000384235 [99%]
TANK-015 - ENSP00000398157 [99%]
TANK-016 - ENSP00000411041 [99%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human colon shows distinct cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:25 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 213, 118, 83, 50, 33, 26, 18
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

47.8, 46.2, 27.6, 27.5, 21.9, 18.8, 15.9, 14.9, 14.5, 13.6, 12.2 47.8, 46.2, 30.6, 27.6, 27.5, 21.9, 21.8, 18.8, 15.9, 14.9, 14.5, 13.6, 12.2, 4.2 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line Hep-G2 shows positivity in cytoplasm.
More information
  

Antibody dilution

1:103  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:30000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
TANK-001
 
TANK-002
 
TANK-003
 
TANK-004
 
TANK-006
 
TANK-008
 
TANK-012
 
TANK-014
 
TANK-015
 
TANK-016
 
TANK-021
 
TANK-022
 
TANK-201
 
 »