GYPC

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008965

 

Antibody CAB009445

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA008965 sc-20628 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

47  

Antigen sequence

RYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
 
 

Matching transcripts

GYPC-001 - ENSP00000259254 [100%]
GYPC-002 - ENSP00000386904 [100%]
GYPC-201 - ENSP00000349354 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong immunoreactivity in erythrocytes present in blood vessel and moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human fallopian tube shows selective positivity in erythrocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:200 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419537)
More information
  

Target mass (kDa)

13.8, 11.9, 11.5 13.8, 11.9, 11.5 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & vesicles.
More information
 

Antibody dilution

 1:200 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
GYPC-001
 
GYPC-002
 
GYPC-201