ANGPTL2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040933

 

Antibody HPA041299

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040933 HPA041299 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

82 52 

Antigen sequence

QEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQQRVTGAICVN
SKEPEVLLENRVHKQELELLNNELLKQKRQIE
 
QLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQR
VP
 

Matching transcripts

ANGPTL2-001 - ENSP00000362524 [100%]
 ANGPTL2-001 - ENSP00000362524 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, upper shows strong membranous and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of plasma in human small intestine.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1000 1:150 

Literature conformity

Partly consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Not done Mainly not consistent with RNAseq data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402146)
More information
 

Target mass (kDa)

57.1 57.1 

Antibody dilution

1:250 1:125 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ANGPTL2-001