RAB30

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA054514

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA054514 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

42 

Antigen sequence

RSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVG
 

Matching transcripts

RAB30-001 - ENSP00000435189 [100%]
RAB30-003 - ENSP00000260056 [100%]
RAB30-004 - ENSP00000433243 [100%]
RAB30-010 - ENSP00000434953 [100%]
RAB30-011 - ENSP00000432193 [100%]
RAB30-012 - ENSP00000437235 [100%]
RAB30-013 - ENSP00000435089 [100%]
RAB30-014 - ENSP00000436587 [100%]
RAB30-015 - ENSP00000433832 [100%]
RAB30-002 - ENSP00000434974 [95%]
RAB30-005 - ENSP00000432336 [83%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:125 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

23.1, 19.2, 19.0, 15.9, 13.9, 13.1, 11.0, 8.8 

Antibody dilution

1:160 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1250 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
RAB30-001
 
RAB30-002
 
RAB30-003
 
RAB30-004
 
RAB30-005
 
RAB30-010
 
RAB30-011
 
RAB30-012
 
RAB30-013
 
RAB30-014
 
RAB30-015
 
 »