NEK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020873

 

Antibody HPA040413

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA020873 HPA040413 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

146 93 

Antigen sequence

NLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVI
PLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEA
ELQLQTELLENTTIRSEISPEGEKYKPLITGEKKVQCISHEINPSA
 
VLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSK
QQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKR
 

Matching transcripts

NEK1-001 - ENSP00000408020 [100%]
NEK1-002 - ENSP00000427653 [100%]
NEK1-003 - ENSP00000423332 [100%]
NEK1-004 - ENSP00000424757 [100%]
NEK1-005 - ENSP00000424938 [100%]
 NEK1-001 - ENSP00000408020 [100%]
NEK1-002 - ENSP00000427653 [100%]
NEK1-003 - ENSP00000423332 [100%]
NEK1-004 - ENSP00000424757 [100%]
NEK1-005 - ENSP00000424938 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:300 1:400 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

145.8, 142.8, 141.1, 138.1, 135.3 145.8, 142.8, 141.1, 138.1, 135.3 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-251 MG shows positivity in nuclear membrane.
More information
 

Antibody dilution

 1:108 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
NEK1-001
 
NEK1-002
 
NEK1-003
 
NEK1-004
 
NEK1-005