CASC5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026624

 

Antibody HPA049647

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA026624 HPA049647 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

149 147 

Antigen sequence

HHTEEDIDKSANSVLIKNLSRTPSSCSSSLDSIKADGTSLDFSTYRSSQM
ESQFLRDTICEESLREKLQDGRITIREFFILLQVHILIQKPRQSNLPGNF
TVNTPPTPEDLMLSQYVYRPKIQIYREDCEARRQKIEELKLSASNQDKL
 
DVTKQVIQTHVNAGEAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQT
VHLPPLPEQLLELGNKAHNDMHIVQATEIHNINIISSNAKDSRDEENKKS
HNGAETTSLPPKTVFKDKVRRCSLGIFLPRLPNKRNCSVTGIDDLEQ
 

Matching transcripts

CASC5-001 - ENSP00000382576 [100%]
CASC5-002 - ENSP00000335463 [100%]
CASC5-013 - ENSP00000432565 [100%]
 CASC5-001 - ENSP00000382576 [100%]
CASC5-002 - ENSP00000335463 [100%]
CASC5-013 - ENSP00000432565 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows distinct nuclear positivity in cells in seminiferus ducts.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:60  

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:50 1:81 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

265.4, 262.6, 155.0 265.4, 262.6, 155.0 

Antibody dilution

1:250 1:270 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3250 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CASC5-001
 
CASC5-002
 
CASC5-013