SMARCAL1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020337

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA020337 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

141 

Antigen sequence

SYELGQGHAQASPEIRFTPFANPTHKPLAKPKSSQETPAHSSGQPPRDAK
LEAKTAKASPSGQNISYIHSSSESVTPRTEGRLQQKSGSSVQKGVNSQKG
KCVRNGDRFQVLIGYNAELIAVFKTLPSKNYDPDTKTWNFS
 

Matching transcripts

SMARCAL1-001 - ENSP00000349823 [100%]
SMARCAL1-002 - ENSP00000375974 [100%]
SMARCAL1-003 - ENSP00000350940 [100%]
SMARCAL1-010 - ENSP00000392997 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:250 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:200 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

105.9, 88.4, 35.3 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
SMARCAL1-001
 
SMARCAL1-002
 
SMARCAL1-003
 
SMARCAL1-010