METTL5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038223

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA038223 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

51 

Antigen sequence

DIDEDALEIFNRNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFG
T
 

Matching transcripts

METTL5-001 - ENSP00000260953 [100%]
METTL5-002 - ENSP00000376415 [100%]
METTL5-003 - ENSP00000386582 [100%]
METTL5-004 - ENSP00000387056 [100%]
METTL5-005 - ENSP00000386703 [100%]
METTL5-010 - ENSP00000307903 [100%]
METTL5-008 - ENSP00000395792 [80%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:175 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli & cytoplasm.
More information
 

Antibody dilution

1:70 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

27.8, 23.7, 22.4, 18.6, 14.4 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
METTL5-001
 
METTL5-002
 
METTL5-003
 
METTL5-004
 
METTL5-005
 
METTL5-008
 
METTL5-010