CDK15

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015786

 

Antibody HPA057165

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA015786 HPA057165 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

86 36 

Antigen sequence

PRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQ
LYQLPDEESLFTVSGVRLKPEMCDLLASYQKGHHPA
 
MTSFHPRGLQAARAQKFKSKRPRSNSDCFQEEDLRQ
 

Matching transcripts

CDK15-001 - ENSP00000260967 [100%]
CDK15-003 - ENSP00000386901 [100%]
CDK15-006 - ENSP00000406472 [93%]
 CDK15-001 - ENSP00000260967 [100%]
CDK15-003 - ENSP00000386901 [100%]
CDK15-006 - ENSP00000406472 [100%]
CDK15-007 - ENSP00000412775 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows cytoplasmic positivity in renal tubules.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:25  

Literature conformity

No avaliable gene/protein characterization data  

RNA consistency

Mainly not consistent with RNA expression data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line BJ shows positivity in nucleus & the Golgi apparatus.
More information
 Immunofluorescent staining of human cell line BJ shows positivity in nucleus & vesicles.
More information
 

Antibody dilution

1:71 1:62 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408389)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

48.3, 43.6 48.3, 45.0, 43.6 

Antibody dilution

1:250 1:210 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:2500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CDK15-001
 
CDK15-003
 
CDK15-006
 
CDK15-007