VWA9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040255

 

Antibody HPA040651

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040255 HPA040651 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

108 101 

Antigen sequence

LTADVQVFPRPEPFVVDEEIDPIPKVINTDLEIVGFIDIADISSPPVLSR
HLVLPIALNKEGDEVGTGITDDNEDENSANQIAGKIPNFCVLLHGSLKVE
GMVAIVQL
 
GCLGIGRGSLRHSLATQNQRSESNRFPLPFPFPSKLYIMCMANLEELQST
DSLECLERLIDLNNGEGQIFTIDGPLCLKNVQSMFGKLIDLAYTPFHAVL
K
 

Matching transcripts

VWA9-002 - ENSP00000457624 [100%]
VWA9-003 - ENSP00000396314 [100%]
VWA9-004 - ENSP00000408429 [100%]
VWA9-006 - ENSP00000402898 [100%]
VWA9-008 - ENSP00000326379 [100%]
VWA9-201 - ENSP00000379006 [100%]
VWA9-007 - ENSP00000456460 [99%]
 VWA9-002 - ENSP00000457624 [100%]
VWA9-003 - ENSP00000396314 [100%]
VWA9-004 - ENSP00000408429 [100%]
VWA9-006 - ENSP00000402898 [100%]
VWA9-007 - ENSP00000456460 [100%]
VWA9-008 - ENSP00000326379 [100%]
VWA9-201 - ENSP00000379006 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts and leydig cells.
More information
 Immunohistochemical staining of human stomach, lower shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1200 1:120 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & mitochondria.
More information
 Application not done for this antibody. 

Antibody dilution

1:108  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.3, 57.5, 53.6, 51.6, 50.7, 48.4 61.3, 57.5, 53.6, 51.6, 50.7, 48.4 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:30000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
VWA9-002
 
VWA9-003
 
VWA9-004
 
VWA9-006
 
VWA9-007
 
VWA9-008
 
VWA9-201