BMPR1B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046821

 

Antibody CAB009634

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA046821 sc-25455 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

76  

Antigen sequence

GKLNVGTKKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTM
IEEDDSGLPVVTSGCLGLEGSDFQCR
 
 

Matching transcripts

BMPR1B-001 - ENSP00000426617 [100%]
BMPR1B-002 - ENSP00000378389 [100%]
BMPR1B-003 - ENSP00000264568 [100%]
BMPR1B-004 - ENSP00000421144 [100%]
BMPR1B-005 - ENSP00000425444 [100%]
BMPR1B-006 - ENSP00000424693 [100%]
BMPR1B-007 - ENSP00000421671 [100%]
BMPR1B-201 - ENSP00000401907 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:75 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

60.6, 56.9, 13.9, 12.5 60.6, 56.9, 13.9, 12.5 

Antibody dilution

1:1240 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
More information
  

Antibody dilution

1:200  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:9950  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
BMPR1B-001
 
BMPR1B-002
 
BMPR1B-003
 
BMPR1B-004
 
BMPR1B-005
 
BMPR1B-006
 
BMPR1B-007
 
BMPR1B-201