GUCD1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA022786

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA022786 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

87 

Antigen sequence

MHHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKV
LVEKCTVSVKDIQAHLAQGHVAIVLVNSGVLHCDLCS
 

Matching transcripts

GUCD1-001 - ENSP00000386076 [100%]
GUCD1-002 - ENSP00000405985 [100%]
GUCD1-003 - ENSP00000384121 [100%]
GUCD1-004 - ENSP00000381297 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:20 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:7 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410517)
More information
 

Target mass (kDa)

33.5, 27.2 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
GUCD1-001
 
GUCD1-002
 
GUCD1-003
 
GUCD1-004