CERS5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026589

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA026589 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

35 

Antigen sequence

GPLSLLWGWLWSERFWLPENVSWADLEGPADGYGY
 

Matching transcripts

CERS5-001 - ENSP00000325485 [100%]
CERS5-002 - ENSP00000407896 [100%]
CERS5-003 - ENSP00000369536 [100%]
CERS5-004 - ENSP00000447410 [100%]
CERS5-008 - ENSP00000446937 [100%]
CERS5-010 - ENSP00000448755 [100%]
CERS5-011 - ENSP00000448257 [100%]
CERS5-012 - ENSP00000446931 [100%]
CERS5-025 - ENSP00000450072 [100%]
CERS5-026 - ENSP00000442918 [100%]
CERS5-027 - ENSP00000448794 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human colon shows nucleolar positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:50 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
More information
 

Antibody dilution

1:50 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

45.8, 41.2, 22.2, 19.9, 10.6, 10.5, 8.8, 8.7, 8.3, 7.5 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
CERS5-001
 
CERS5-002
 
CERS5-003
 
CERS5-004
 
CERS5-008
 
CERS5-010
 
CERS5-011
 
CERS5-012
 
CERS5-025
 
CERS5-026
 
CERS5-027
 
 »