SLC12A6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA034563

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA034563 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

86 

Antigen sequence

RVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIED
LSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDE
 

Matching transcripts

SLC12A6-003 - ENSP00000346112 [100%]
SLC12A6-004 - ENSP00000452776 [100%]
SLC12A6-007 - ENSP00000453702 [100%]
SLC12A6-009 - ENSP00000453473 [100%]
SLC12A6-010 - ENSP00000454168 [100%]
SLC12A6-011 - ENSP00000452828 [100%]
SLC12A6-012 - ENSP00000452771 [100%]
SLC12A6-020 - ENSP00000454069 [100%]
SLC12A6-002 - ENSP00000380819 [83%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Literature conformity

Consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & vesicles.
More information
 

Antibody dilution

1:28 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

127.6, 126.6, 126.0, 99.3, 16.9, 14.8 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SLC12A6-002
 
SLC12A6-003
 
SLC12A6-004
 
SLC12A6-007
 
SLC12A6-009
 
SLC12A6-010
 
SLC12A6-011
 
SLC12A6-012
 
SLC12A6-020