DUOXA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041578

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041578 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

57 

Antigen sequence

VAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDI
PLSEASS
 

Matching transcripts

DUOXA1-001 - ENSP00000267803 [100%]
DUOXA1-002 - ENSP00000453569 [100%]
DUOXA1-003 - ENSP00000453836 [100%]
DUOXA1-004 - ENSP00000454019 [100%]
DUOXA1-005 - ENSP00000454084 [100%]
DUOXA1-006 - ENSP00000415512 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

53.5, 48.8, 37.8, 33.1 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
DUOXA1-001
 
DUOXA1-002
 
DUOXA1-003
 
DUOXA1-004
 
DUOXA1-005
 
DUOXA1-006