MFGE8

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002807

 

Antibody CAB002753

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA002807 MAB4085 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

3 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

149  

Antigen sequence

LKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGN
DQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQD
PRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLEL
 
 

Matching transcripts

MFGE8-001 - ENSP00000268150 [100%]
MFGE8-003 - ENSP00000444332 [100%]
MFGE8-015 - ENSP00000456281 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
More information
 Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:200 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:13  

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401796)
More information
 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

43.1, 38.3 43.1, 38.3, 37.5, 29.2 

Antibody dilution

1:250 1:5000 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MFGE8-001
 
MFGE8-003
 
MFGE8-015