FTO

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041086

 

Antibody CAB017123

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA041086 2366 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

85  

Antigen sequence

MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLR
REWHARCQSRIARTLPADQKPECRPYWEKDDASMP
 
 

Matching transcripts

FTO-001 - ENSP00000418823 [100%]
FTO-002 - ENSP00000417422 [100%]
FTO-006 - ENSP00000415636 [100%]
FTO-201 - ENSP00000378142 [100%]
FTO-005 - ENSP00000417843 [85%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:225 

Literature conformity

 No avaliable characterization data 

RNA consistency

 Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & vesicles.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 

Antibody dilution

1:200 1:56 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

58.3, 24.3, 14.9, 12.2 58.3, 24.3, 15.0, 14.9, 12.2, 8.3 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
FTO-001
 
FTO-002
 
FTO-005
 
FTO-006
 
FTO-201