CDH13

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001380

 

Antibody CAB025863

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 

Product name

HPA001380 MAB3264 

Host species

Rabbit Rat 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

145  

Antigen sequence

GTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTD
PFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGK
PPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLA
 
 

Matching transcripts

CDH13-001 - ENSP00000454435 [100%]
CDH13-005 - ENSP00000394557 [100%]
CDH13-009 - ENSP00000268613 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human heart muscle shows membranous positivity in myocytes.
More information
 Immunohistochemical staining of human heart muscle shows distinct cytoplasmic and membranous positivity.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:90 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400505)
More information
  

Target mass (kDa)

83.4, 78.3, 73.8 83.4, 78.3, 73.8, 21.1, 19.7, 7.6, 6.4, 5.9, 4.0 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CDH13-001
 
CDH13-005
 
CDH13-009