IRF8

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002267

 

Antibody HPA002531

 

Antibody CAB013480

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Zymed
 

Product name

HPA002267 HPA002531 39-8800 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

2 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

141 122  

Antigen sequence

QGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQF
YNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKS
CGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQIT
 
PDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECG
RSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLV
TGYTTYDAHHSAFSQMVISFYY
 
 

Matching transcripts

IRF8-001 - ENSP00000268638 [100%]
IRF8-009 - ENSP00000455452 [100%]
IRF8-010 - ENSP00000456395 [99%]
 IRF8-001 - ENSP00000268638 [100%]
IRF8-006 - ENSP00000456992 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lymph node shows distinct nuclear positivity in lymphoid cells in reaction centre.
More information
 Immunohistochemical staining of human lymph node shows distinct nuclear positivity in germinal center cells.
More information
 Immunohistochemical staining of human lymph node shows strong nuclear positivity in lymphoid tissue.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:250 1:125 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 213, 118, 83, 50, 33, 26, 18
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

48.4, 24.9, 24.7 48.4, 37.2 48.4, 37.2, 24.9, 24.7, 18.5, 16.8, 15.0, 5.7, 1.5 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line CACO-2 shows positivity in nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

 1:61  

Validation IF

 Supportive: The subcellular location is supported by literature.  
 

ANTIGEN VIEW

? »
 
 
 
IRF8-001
 
IRF8-006
 
IRF8-009
 
IRF8-010