PDPK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035199

 

Antibody CAB004272

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA035199 sc-17765 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

74  

Antigen sequence

HSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAG
GNPWHQFVENNLILKMGPVDKRKG
 
 

Matching transcripts

PDPK1-001 - ENSP00000344220 [100%]
PDPK1-002 - ENSP00000268673 [100%]
PDPK1-003 - ENSP00000373876 [100%]
PDPK1-201 - ENSP00000346895 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:6000 

Literature conformity

 Consistent with extensive gene/protein characterization data 

RNA consistency

 Consistent with RNAseq data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

63.2, 60.6, 60.3, 48.2 63.2, 60.6, 60.3, 50.8, 48.2, 16.8, 10.3, 5.9, 5.0, 3.5 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:133  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PDPK1-001
 
PDPK1-002
 
PDPK1-003
 
PDPK1-201