PDPK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035199

 

Antibody CAB004272

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA035199 sc-17765 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

74  

Antigen sequence

HSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAG
GNPWHQFVENNLILKMGPVDKRKG
 
 

Matching transcripts

PDPK1-001 - ENSP00000344220 [100%]
PDPK1-002 - ENSP00000268673 [100%]
PDPK1-003 - ENSP00000373876 [100%]
PDPK1-201 - ENSP00000346895 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:6000 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

63.2, 60.6, 60.3, 48.2 63.2, 60.6, 60.3, 50.8, 48.2, 16.8, 10.3, 5.9, 5.0, 3.5 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in cytoplasm.
More information
  

Antibody dilution

1:133  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PDPK1-001
 
PDPK1-002
 
PDPK1-003
 
PDPK1-201