KSR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011215

 

Antibody CAB009623

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA011215 sc-25416 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

125  

Antigen sequence

SMIFGVKCKHCRLKCHNKCTKEAPACRISFLPLTRLRRTESVPSDINNPV
DRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTS
SNPSSATTPPNPSPGQRDSRFNFPA
 
 

Matching transcripts

KSR1-001 - ENSP00000381958 [100%]
KSR1-011 - ENSP00000381952 [100%]
KSR1-201 - ENSP00000268763 [100%]
KSR1-202 - ENSP00000323178 [100%]
KSR1-203 - ENSP00000438795 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach shows distinct cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:175 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

102.2, 97.1, 87.3, 84.7, 69.1 102.2, 97.1, 87.3, 84.7, 69.1, 16.3, 15.7, 14.8, 12.8, 10.7, 5.1 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
KSR1-001
 
KSR1-011
 
KSR1-201
 
KSR1-202
 
KSR1-203