PRPSAP2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021881

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA021881 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

63 

Antigen sequence

VTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQ
EPNRETRVQIQES
 

Matching transcripts

PRPSAP2-001 - ENSP00000460967 [100%]
PRPSAP2-004 - ENSP00000416964 [100%]
PRPSAP2-005 - ENSP00000268835 [100%]
PRPSAP2-008 - ENSP00000399625 [100%]
PRPSAP2-009 - ENSP00000402612 [100%]
PRPSAP2-010 - ENSP00000395127 [100%]
PRPSAP2-012 - ENSP00000415446 [100%]
PRPSAP2-013 - ENSP00000401144 [100%]
PRPSAP2-017 - ENSP00000439129 [100%]
PRPSAP2-019 - ENSP00000460138 [100%]
PRPSAP2-022 - ENSP00000458600 [100%]
PRPSAP2-027 - ENSP00000416021 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 

Antibody dilution

1:5 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400988)
More information
 

Target mass (kDa)

40.9, 35.5, 29.6, 27.1, 21.8, 19.9, 17.9, 15.6, 11.6, 10.5 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
PRPSAP2-001
 
PRPSAP2-004
 
PRPSAP2-005
 
PRPSAP2-008
 
PRPSAP2-009
 
PRPSAP2-010
 
PRPSAP2-012
 
PRPSAP2-013
 
PRPSAP2-017
 
PRPSAP2-019
 
PRPSAP2-022
 
PRPSAP2-027
 
 »