NPEPPS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021453

 

Antibody HPA045649

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA021453 HPA045649 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

82 88 

Antigen sequence

TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQA
DMQEEKNRIERVLGATLLPDLIQKVLTFALSE
 
VMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGT
LKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFEA
 

Matching transcripts

NPEPPS-001 - ENSP00000320324 [100%]
NPEPPS-002 - ENSP00000433287 [100%]
NPEPPS-201 - ENSP00000442461 [100%]
 NPEPPS-001 - ENSP00000320324 [100%]
NPEPPS-002 - ENSP00000433287 [100%]
NPEPPS-011 - ENSP00000437019 [100%]
NPEPPS-201 - ENSP00000442461 [99%]
 

Other gene match

 RP11-1407O15.2 - ENSG00000174093 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human pancreas shows moderate cytoplasmic and nuclear positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:275 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

103.3, 103.0, 94.5 103.3, 103.0, 94.5, 53.7, 53.1, 48.5, 22.3 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
NPEPPS-001
 
NPEPPS-002
 
NPEPPS-011
 
NPEPPS-201