ERBB2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001338

 

Antibody HPA001383

 

Antibody CAB000043

 

Antibody CAB020416

 

Antibody CAB062555

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 Novocastra
 Atlas Antibodies
 

Product name

HPA001338 HPA001383 A0485 NCL-CBE-356 AMAb90627 

Host species

Rabbit Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb msAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity Not known Protein A/G 

Released in version

12 1 1 5 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide Recombinant protein Recombinant protein 

Length (aa)

123 124    

Antigen sequence

LVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAE
EYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAP
RSPLAPSEGAGSDVFDGDGAPHR
 
LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLER
PKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDN
LYYWDQDPPERGAPPSTFKGTPTA
 
 
 
 

Matching transcripts

ERBB2-001 - ENSP00000462438 [96%]
ERBB2-004 - ENSP00000404047 [96%]
ERBB2-008 - ENSP00000269571 [96%]
ERBB2-201 - ENSP00000385185 [96%]
ERBB2-203 - ENSP00000443562 [96%]
ERBB2-204 - ENSP00000446466 [96%]
 ERBB2-001 - ENSP00000462438 [100%]
ERBB2-004 - ENSP00000404047 [100%]
ERBB2-008 - ENSP00000269571 [100%]
ERBB2-201 - ENSP00000385185 [100%]
ERBB2-203 - ENSP00000443562 [100%]
ERBB2-204 - ENSP00000446466 [100%]
    

Other gene match

     

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

 Immunohistochemical staining of human urinary bladder shows moderate membranous and cytoplasmic positivity in urothelial cells.
More information
 Immunohistochemical staining of human rectum shows weak cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells.
More information
 Immunohistochemical staining of human urinary bladder shows positivity in urothelial cells.
More information
 

Retrieval method

 HIER pH6 HIER pH9 HIER pH6 HIER pH6 

Antibody dilution

 1:100 1:1500 1:50 1:80 

Validation IH

 Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

     

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

137.9, 136.5, 134.9, 107.6 137.9, 136.5, 134.9, 107.6 137.9, 136.5, 134.9, 117.1, 107.6, 66.5, 27.7, 19.4, 18.1, 15.6, 11.5, 10.5, 9.7 137.9, 136.5, 134.9, 117.1, 107.6, 66.5, 27.7, 19.4, 18.1, 15.6, 11.5, 10.5, 9.7  

Antibody dilution

1:250 1:250 1:500 1:500  

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size  

         Immunofluorescence

Image

     

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & plasma membrane.
More information
    

Antibody dilution

1:67 1:75    

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.    

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
    

Antibody dilution

1:6000 1:3000    

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
ERBB2-001
 
ERBB2-004
 
ERBB2-008
 
ERBB2-201
 
ERBB2-203
 
ERBB2-204