GRB7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA057084

 

Antibody CAB005226

 

Antibody CAB073538

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Monash University MATF
 

Product name

HPA057084 sc-606 HUPO 11 (anti-GRB7) 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb msAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity Protein A/G 

Released in version

14 3 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Not known 

Length (aa)

70   

Antigen sequence

QGHTTGSVKPLSRSDAMELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTP
LPEEVKRSQPLLIPTTGRKL
 
 
 

Matching transcripts

GRB7-006 - ENSP00000403459 [99%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1000 1:15 1:22000 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNA expression data Mainly not consistent with RNA expression data Mainly not consistent with RNA expression data 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Application not done for this antibody. Immunofluorescent staining of human cell line HeLa shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

  1:200 

Validation IF

  Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

62.1 62.1, 59.7, 49.4, 12.6 62.1, 59.7, 49.4, 12.6 

Antibody dilution

1:390 1:500 1:1000 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:4650   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
GRB7-006