NFIC

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA052625

 

Antibody CAB004300

 

Antibody CAB004674

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 University of Gothenburg
 Abnova
 

Product name

HPA052625 NF1-C2 H00004782-M01 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb msAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

12 2 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Recombinant protein 

Length (aa)

71   

Antigen sequence

RTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDME
GGISSPVKKTEMDKSPFNSPS
 
 
 

Matching transcripts

NFIC-001 - ENSP00000465655 [100%]
NFIC-003 - ENSP00000378543 [100%]
NFIC-004 - ENSP00000342194 [100%]
NFIC-005 - ENSP00000466647 [100%]
NFIC-006 - ENSP00000396843 [100%]
NFIC-011 - ENSP00000465177 [100%]
NFIC-201 - ENSP00000301935 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

 Immunohistochemical staining of human adrenal gland shows moderate nuclear positivity in cortical cells.
More information
 Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:1000 1:200 

Validation IH

 Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

55.7, 54.7, 48.9, 47.9, 47.6, 45.4 55.7, 54.7, 48.9, 47.9, 47.6, 45.4 55.7, 54.7, 48.9, 47.9, 47.6, 45.4 

Antibody dilution

1:400 1:500 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus & nucleoli.
More information
   

Antibody dilution

1:80   

Validation IF

Supportive: The subcellular location is supported by literature.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3200   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
NFIC-001
 
NFIC-003
 
NFIC-004
 
NFIC-005
 
NFIC-006
 
NFIC-011
 
NFIC-201