HUNK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027295

 

Antibody HPA027372

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA027295 HPA027372 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

78 86 

Antigen sequence

SSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQ
PGPGSTGIPHKEDPLMLDMVRSFESVDR
 
NSPVSLACRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSPPKE
EGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIG
 

Matching transcripts

HUNK-001 - ENSP00000270112 [100%]
 HUNK-001 - ENSP00000270112 [99%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human gall bladder shows strong granular cytoplasmic and nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:450 1:75 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

79.7 79.7 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
HUNK-001