APP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001462

 

Antibody CAB000157

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 AbD Serotec
 

Product name

HPA001462 MCA2172 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

2 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

121  

Antigen sequence

ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGAD
SVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRH
DSGYEVHHQKLVFFAKDVGSN
 
 

Matching transcripts

APP-001 - ENSP00000350578 [99%]
APP-002 - ENSP00000346129 [99%]
APP-003 - ENSP00000345463 [99%]
APP-004 - ENSP00000284981 [99%]
APP-015 - ENSP00000398879 [99%]
APP-016 - ENSP00000387483 [99%]
APP-202 - ENSP00000352760 [99%]
APP-203 - ENSP00000388538 [99%]
APP-011 - ENSP00000397795 [84%]
APP-201 - ENSP00000351796 [84%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH9 

Antibody dilution

1:350 1:2000 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

86.9, 85.0, 84.8, 84.5, 80.8, 78.7, 75.1, 72.6, 31.9 86.9, 85.0, 84.8, 84.5, 80.8, 78.7, 75.1, 72.6, 55.0, 31.9, 20.3 

Antibody dilution

1:250 1:5000 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in Golgi apparatus & vesicles.
More information
  

Antibody dilution

1:50  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
APP-001
 
APP-002
 
APP-003
 
APP-004
 
APP-011
 
APP-015
 
APP-016
 
APP-201
 
APP-202
 
APP-203