AKT1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002891

 

Antibody CAB003765

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA002891 1081-1 

Host species

Rabbit Rabbit 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

2 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

104  

Antigen sequence

ERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEM
EVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKE
VIVA
 
 

Matching transcripts

AKT1-001 - ENSP00000270202 [100%]
AKT1-002 - ENSP00000384293 [100%]
AKT1-003 - ENSP00000385326 [100%]
AKT1-004 - ENSP00000451166 [100%]
AKT1-005 - ENSP00000451828 [100%]
AKT1-006 - ENSP00000450688 [100%]
AKT1-007 - ENSP00000443897 [100%]
AKT1-013 - ENSP00000451290 [80%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human gall bladder shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells, cells in molecular layer
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:50 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in microtubules & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:91  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423056)
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

55.7, 48.3, 12.2 55.7, 48.3, 19.0, 18.6, 12.2, 11.0 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
AKT1-001
 
AKT1-002
 
AKT1-003
 
AKT1-004
 
AKT1-005
 
AKT1-006
 
AKT1-007
 
AKT1-013