CAPN10

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004170

 

Antibody HPA056098

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004170 HPA056098 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

100 142 

Antigen sequence

FWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGGLAERWNLKGVAGSGG
QQDRPGRWEHRTCRQLLHLKDQCLISCCVLSPRAGARELGEFHAFIVSDL
 
QEGEFWVEEEEFLREFDELTVGYPVTEAGHLQSLYTERLLCHTRALPGAW
VKGQSAGGCRNNSGFPSNPKFWLRVSEPSEVYIAVLQRSRLHAADWAGRA
RALVGDSHTSWSPASIPGKHYQAVGLHLWKGVTLGTTLFPVP
 

Matching transcripts

CAPN10-001 - ENSP00000375844 [100%]
CAPN10-003 - ENSP00000349556 [100%]
CAPN10-004 - ENSP00000400144 [100%]
CAPN10-005 - ENSP00000384422 [100%]
CAPN10-007 - ENSP00000270362 [100%]
CAPN10-009 - ENSP00000375843 [100%]
CAPN10-201 - ENSP00000375842 [100%]
 CAPN10-004 - ENSP00000400144 [100%]
CAPN10-201 - ENSP00000375842 [100%]
CAPN10-001 - ENSP00000375844 [92%]
CAPN10-003 - ENSP00000349556 [92%]
CAPN10-005 - ENSP00000384422 [92%]
CAPN10-007 - ENSP00000270362 [92%]
CAPN10-009 - ENSP00000375843 [92%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:25  

Literature conformity

Consistent with gene/protein characterization data  

RNA consistency

Mainly not consistent with RNAseq data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

75.0, 72.9, 60.7, 58.0, 57.8, 50.0 75.0, 72.9, 60.7, 58.0, 57.8, 50.0 

Antibody dilution

1:250 1:80 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:9 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
CAPN10-001
 
CAPN10-003
 
CAPN10-004
 
CAPN10-005
 
CAPN10-007
 
CAPN10-009
 
CAPN10-201