CAPN10

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004170

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004170 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

100 

Antigen sequence

FWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGGLAERWNLKGVAGSGG
QQDRPGRWEHRTCRQLLHLKDQCLISCCVLSPRAGARELGEFHAFIVSDL
 

Matching transcripts

CAPN10-001 - ENSP00000375844 [100%]
CAPN10-003 - ENSP00000349556 [100%]
CAPN10-004 - ENSP00000400144 [100%]
CAPN10-005 - ENSP00000384422 [100%]
CAPN10-007 - ENSP00000270362 [100%]
CAPN10-009 - ENSP00000375843 [100%]
CAPN10-201 - ENSP00000375842 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

75.0, 72.9, 60.7, 58.0, 57.8, 50.0 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CAPN10-001
 
CAPN10-003
 
CAPN10-004
 
CAPN10-005
 
CAPN10-007
 
CAPN10-009
 
CAPN10-201