KLK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000764

 

Antibody CAB000070

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 

Product name

HPA000764 A0562 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

1 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

143  

Antigen sequence

SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLP
TQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKV
TKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCA
 
 

Matching transcripts

KLK3-003 - ENSP00000314151 [100%]
KLK3-014 - ENSP00000471827 [95%]
KLK3-015 - ENSP00000471155 [86%]
KLK3-007 - ENSP00000353829 [83%]
KLK3-010 - ENSP00000472907 [83%]
KLK3-013 - ENSP00000470523 [82%]
  

Other gene match

KLK2 - ENSG00000167751 [80%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 None 

Antibody dilution

1:500 1:4000 

Validation IH

Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

28.7, 28.6, 26.3, 25.1, 23.7, 19.1 28.7, 28.6, 26.3, 25.1, 23.7, 21.3, 19.2, 19.1, 13.9, 11.1, 9.9 

Antibody dilution

1:250 1:5000 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
KLK3-003
 
KLK3-007
 
KLK3-010
 
KLK3-013
 
KLK3-014
 
KLK3-015