ADCY10

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015243

 

Antibody HPA017749

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA015243 HPA017749 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

87 128 

Antigen sequence

NLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQ
GNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSW
 
RNTTYIVIGAVQPNDISNKICLDLNVSCISKELDSYLGEGSCGIPFYCEE
LLKNLEHHEVLVFQQTESEEKTNRTWNNLFKYSIKLTEKLNMVTLHSDKE
SEEVCHLTSGVRLKNLSPPTSLKEISLI
 

Matching transcripts

ADCY10-001 - ENSP00000356825 [100%]
ADCY10-002 - ENSP00000356822 [100%]
ADCY10-201 - ENSP00000441992 [100%]
 ADCY10-001 - ENSP00000356825 [100%]
ADCY10-002 - ENSP00000356822 [100%]
ADCY10-201 - ENSP00000441992 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells of red pulp.
More information
 Immunohistochemical staining of human kidney shows strong positivity in tubuli.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:25 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:9 1:18 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

187.1, 176.6, 169.7 187.1, 176.6, 169.7 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ADCY10-001
 
ADCY10-002
 
ADCY10-201