CERS2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027262

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA027262 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

75 

Antigen sequence

TPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSG
RQVARWFRRRRNQDRPSLLKKFREA
 

Matching transcripts

CERS2-001 - ENSP00000357950 [99%]
CERS2-003 - ENSP00000357945 [99%]
CERS2-004 - ENSP00000355020 [99%]
CERS2-006 - ENSP00000393239 [99%]
CERS2-014 - ENSP00000452810 [99%]
CERS2-201 - ENSP00000271688 [99%]
CERS2-005 - ENSP00000394012 [89%]
CERS2-012 - ENSP00000454160 [87%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:500 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane & endoplasmic reticulum.
More information
 

Antibody dilution

1:100 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

44.9, 44.5, 36.4, 29.8, 26.8, 23.3, 15.4 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CERS2-001
 
CERS2-003
 
CERS2-004
 
CERS2-005
 
CERS2-006
 
CERS2-012
 
CERS2-014
 
CERS2-201