ARNT

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001759

 

Antibody CAB004318

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA001759 sc-17811 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

121  

Antigen sequence

RFSCLRPRVAGTTEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRP
GLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHS
EIERRRRNKMTAYITELSDMV
 
 

Matching transcripts

ARNT-001 - ENSP00000351407 [90%]
ARNT-007 - ENSP00000425899 [90%]
ARNT-010 - ENSP00000346372 [90%]
ARNT-006 - ENSP00000423851 [88%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human placenta shows strong nuclear and moderate cytoplasmic positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:100 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nuclei.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:19 1:25 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

86.6, 86.4, 85.3, 45.9 86.6, 86.4, 85.3, 84.9, 45.9, 5.4 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ARNT-001
 
ARNT-006
 
ARNT-007
 
ARNT-010