ADAM15

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011633

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA011633 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

131 

Antigen sequence

CQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQ
LQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTL
PGTACGPGLVCIDHRCQRVDLLGAQECRSKC
 

Matching transcripts

ADAM15-001 - ENSP00000271836 [100%]
ADAM15-002 - ENSP00000357398 [100%]
ADAM15-019 - ENSP00000349436 [100%]
ADAM15-020 - ENSP00000403843 [100%]
ADAM15-021 - ENSP00000432347 [100%]
ADAM15-022 - ENSP00000434227 [100%]
ADAM15-023 - ENSP00000352226 [100%]
ADAM15-024 - ENSP00000353892 [100%]
ADAM15-025 - ENSP00000357397 [100%]
ADAM15-026 - ENSP00000432927 [100%]
ADAM15-037 - ENSP00000348227 [100%]
ADAM15-201 - ENSP00000357395 [100%]
ADAM15-027 - ENSP00000476000 [84%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:20 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418416)
More information
 

Target mass (kDa)

93.0, 92.8, 90.4, 90.3, 88.8, 88.7, 87.7, 86.3, 86.1, 83.7, 68.3, 55.5, 55.4 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
ADAM15-001
 
ADAM15-002
 
ADAM15-019
 
ADAM15-020
 
ADAM15-021
 
ADAM15-022
 
ADAM15-023
 
ADAM15-024
 
ADAM15-025
 
ADAM15-026
 
ADAM15-027
 
ADAM15-037
 
ADAM15-201
 
 »