KCNN3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA017990

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA017990 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

102 

Antigen sequence

VDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIA
DTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSS
SS
 

Matching transcripts

KCNN3-001 - ENSP00000271915 [100%]
KCNN3-002 - ENSP00000354764 [100%]
KCNN3-003 - ENSP00000351295 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:800 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

81.4, 48.0, 47.1 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:60000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
KCNN3-001
 
KCNN3-002
 
KCNN3-003