CNTN4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021068

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA021068 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

100 

Antigen sequence

GTLNITIVNLSDAGMYQCLAENKHGVIFSNAELSVIAVGPDFSRTLLKRV
TLVKVGGEVVIECKPKASPKPVYTWKKGRDILKENERITISEDGNLRIIN
 

Matching transcripts

CNTN4-001 - ENSP00000380602 [100%]
CNTN4-002 - ENSP00000380600 [100%]
CNTN4-009 - ENSP00000396010 [100%]
CNTN4-201 - ENSP00000351267 [100%]
CNTN4-202 - ENSP00000413642 [100%]
CNTN4-203 - ENSP00000392077 [100%]
CNTN4-015 - ENSP00000422120 [86%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human skin shows strong cytoplasmic positivity in epidermal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:600 

Literature conformity

Not consistent with gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403574)
More information
 

Target mass (kDa)

113.5, 88.9, 76.7, 15.9 

Antibody dilution

1:125 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CNTN4-001
 
CNTN4-002
 
CNTN4-009
 
CNTN4-015
 
CNTN4-201
 
CNTN4-202
 
CNTN4-203