AGTR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003596

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003596 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

39 

Antigen sequence

LQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKP
 

Matching transcripts

AGTR1-001 - ENSP00000273430 [100%]
AGTR1-002 - ENSP00000419422 [100%]
AGTR1-003 - ENSP00000385612 [100%]
AGTR1-005 - ENSP00000419783 [100%]
AGTR1-006 - ENSP00000418084 [100%]
AGTR1-007 - ENSP00000418851 [100%]
AGTR1-201 - ENSP00000385641 [100%]
AGTR1-202 - ENSP00000398832 [100%]
AGTR1-203 - ENSP00000443186 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human lung shows strong membranous and cytoplasmic positivity in alveolar cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

41.1 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AGTR1-001
 
AGTR1-002
 
AGTR1-003
 
AGTR1-005
 
AGTR1-006
 
AGTR1-007
 
AGTR1-201
 
AGTR1-202
 
AGTR1-203