TRPC1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021130

 

Antibody CAB009387

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA021130 sc-20111 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

5 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

133  

Antigen sequence

HEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICS
HTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTD
QATVENLNELRQDLSKFRNEIRDLLGFRTSKYA
 
 

Matching transcripts

TRPC1-001 - ENSP00000273482 [100%]
TRPC1-002 - ENSP00000419313 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:20 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

91.2, 87.6 91.2, 87.6, 6.7 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in cytoplasm.
More information
  

Antibody dilution

1:143  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
TRPC1-001
 
TRPC1-002