SLIT2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019511

 

Antibody HPA023088

 

Antibody CAB007590

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA019511 HPA023088 AB5701 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

5 5 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

84 89  

Antigen sequence

SAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITNLSKQSTLNFD
SPLYVGGMPGKSNVASLRQAPGQNGTSFHGRIWN
 
LYINSELQDFQKVPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQE
GWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLE
 
 

Matching transcripts

SLIT2-001 - ENSP00000422591 [98%]
SLIT2-002 - ENSP00000427548 [98%]
SLIT2-003 - ENSP00000422261 [98%]
SLIT2-004 - ENSP00000273739 [98%]
SLIT2-011 - ENSP00000423179 [82%]
 SLIT2-001 - ENSP00000422591 [100%]
SLIT2-002 - ENSP00000427548 [100%]
SLIT2-003 - ENSP00000422261 [100%]
SLIT2-004 - ENSP00000273739 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:15 1:35 1:850 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

171.3, 169.9, 169.4, 168.9, 8.5 171.3, 169.9, 169.4, 168.9 171.3, 169.9, 169.4, 168.9, 23.1, 21.7, 16.7, 8.5 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli & vesicles.
More information
   

Antibody dilution

1:10   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SLIT2-001
 
SLIT2-002
 
SLIT2-003
 
SLIT2-004
 
SLIT2-011