ATP10D

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA050808

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA050808 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

98 

Antigen sequence

LFPSPILRAKHFDRLTPEERTKALKKWRGAGKMNQVTSKYANQSAGKSGR
RPMPGPSAVFAMKSASSCAIEQGNLSLCETALDQGYSETKAFEMAGPS
 

Matching transcripts

ATP10D-001 - ENSP00000273859 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:2500 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-549 shows positivity in nucleus but not nucleoli & plasma membrane.
More information
 

Antibody dilution

1:169 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

160.3 

Antibody dilution

1:840 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6750 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ATP10D-001